Anti-CD8A, IgG1, Clone: [CL1529], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90883
Artikelname: Anti-CD8A, IgG1, Clone: [CL1529], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90883
Hersteller Artikelnummer: AMAb90883
Alternativnummer: ATA-AMAB90883-100,ATA-AMAB90883-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD8, Pan-Cancer
CD8a molecule

Anti-CD8A

Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1529]
Isotyp: IgG1
NCBI: 925
UniProt: P01732
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD8A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells outside the reaction centra.
Immunohistochemical staining of human rectum shows strong positivity in a subset of lymphoid cells in lamina propria.
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells in lamina propria.
Immunohistochemical staining of human fallopian tube shows strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
AMAb90883
AMAb90883
AMAb90883