Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90901
Artikelname: Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90901
Hersteller Artikelnummer: AMAb90901
Alternativnummer: ATA-AMAB90901-100,ATA-AMAB90901-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C-Kit, CD117, PBT, SCFR, Pan-Cancer
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Anti-KIT
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1657]
Isotyp: IgG1
NCBI: 3815
UniProt: P10721
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells (macrophages).
Immunohistochemical staining of human stomach shows strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human colon shows strong immunoreactivity in a subset of lymphoid cells.
Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil of the molecular layer.
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90901
AMAb90901
AMAb90901