Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90901
Artikelname: |
Anti-KIT, IgG1, Clone: [CL1657], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB90901 |
Hersteller Artikelnummer: |
AMAb90901 |
Alternativnummer: |
ATA-AMAB90901-100,ATA-AMAB90901-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
C-Kit, CD117, PBT, SCFR, Pan-Cancer |
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL1657] |
Isotyp: |
IgG1 |
NCBI: |
3815 |
UniProt: |
P10721 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
KIT |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells (macrophages). |
|
Immunohistochemical staining of human stomach shows strong positivity in a subset of lymphoid cells. |
|
Immunohistochemical staining of human colon shows strong immunoreactivity in a subset of lymphoid cells. |
|
Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil of the molecular layer. |
|
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control). |
|
Lane 1: Marker [kDa] Lane 2: Human cell line RT-4 |
|
AMAb90901 |
|
|
|
AMAb90901 |
|
AMAb90901 |