Anti-KIT, IgG2a, Clone: [CL1667], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90904
Artikelname: Anti-KIT, IgG2a, Clone: [CL1667], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90904
Hersteller Artikelnummer: AMAb90904
Alternativnummer: ATA-AMAB90904-100,ATA-AMAB90904-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C-Kit, CD117, PBT, SCFR, Pan-Cancer
v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Anti-KIT
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1667]
Isotyp: IgG2a
NCBI: 3815
UniProt: P10721
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human small intestine shows strong immunoreactivity in a subset of lymphoid cells.
Immunohistochemical staining of human tonsil shows strong positivity in a subset of lymphoid cells.
Immunohistochemical staining of human colon shows strong immunoreactivity in some lymphoid cells.
Immunohistochemical staining of human cerebellum shows moderate positivity in the molecular layer.
Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90904
AMAb90904
AMAb90904