Anti-CD40, IgG1, Clone: [CL1673], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90905
Artikelname: Anti-CD40, IgG1, Clone: [CL1673], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90905
Hersteller Artikelnummer: AMAb90905
Alternativnummer: ATA-AMAB90905-100,ATA-AMAB90905-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Bp50, p50, TNFRSF5
CD40 molecule, TNF receptor superfamily member 5
Anti-CD40
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL1673]
Isotyp: IgG1
NCBI: 958
UniProt: P25942
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD40
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using AMAb90905 antibody. Corresponding CD40 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong membranous positivity in germinal center cells.
Immunohistochemical staining of human colon shows moderate membranous positivity in lymphoid cells.
Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Lane 1: Marker [kDa]
Lane 2: Human spleen
AMAb90905
AMAb90905
AMAb90905