Anti-ENG Antibody 100ul, IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal

Artikelnummer: ATA-AMAB90925
Artikelname: Anti-ENG Antibody 100ul, IgG1, Clone: [CL1912], Unconjugated, Mouse, Monoclonal
Artikelnummer: ATA-AMAB90925
Hersteller Artikelnummer: AMAb90925
Alternativnummer: ATA-AMAB90925-100,ATA-AMAB90925-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD105, END, HHT1, ORW, ORW1
endoglin
Anti-ENG
Klonalität: Monoclonal
Konzentration: 0.1
Klon-Bezeichnung: [CL1912]
Isotyp: IgG1
NCBI: 2022
UniProt: P17813
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ENG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human renal cancer shows strong immunoreactivity in the blood vessels.
Immunohistochemical staining of human liver cancer shows positivity in the sinusoids.
Immunohistochemical staining of human stomach cancer shows strong immunoreactivity in the blood vessels walls.
Immunohistochemical staining of human colon shows moderate positivity in the endothelium of blood vessels.
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in the blood vessels.
Immunohistochemical staining of smooth muscle shows absence of positivity in myocytes (negative control).
AMAb90925
AMAb90925
AMAb90925