Anti-VWF, IgG1, Clone: [CL1957], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB90931
- Bilder (10)
| Artikelname: | Anti-VWF, IgG1, Clone: [CL1957], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB90931 |
| Hersteller Artikelnummer: | AMAb90931 |
| Alternativnummer: | ATA-AMAB90931-100,ATA-AMAB90931-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | F8VWF, Pan-Cancer |
| von Willebrand factor |
| Anti-VWF |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL1957] |
| Isotyp: | IgG1 |
| NCBI: | 7450 |
| UniProt: | P04275 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | VWF |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human rectum shows strong immunoreactivity in a blood vessel. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in blood vessels. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong immunoreactivity in blood vessels. |
|
|
Immunohistochemical staining of human testis shows strong positivity in larger and smaller blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human spleen tissue lysate |
|
|
AMAb90931 |
|
|
|
|
|
AMAb90931 |
|
|
AMAb90931 |
Produktgarantie und fachkundiger Support
