Anti-MYH6, IgG1, Clone: [CL2155], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90948
Artikelname: Anti-MYH6, IgG1, Clone: [CL2155], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90948
Hersteller Artikelnummer: AMAb90948
Alternativnummer: ATA-AMAB90948-100,ATA-AMAB90948-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MYH6
myosin, heavy chain 6, cardiac muscle, alpha
Anti-MYH6
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL2155]
Isotyp: IgG1
NCBI: 4624
UniProt: P13533
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MYH6
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunohistochemistry analysis in human heart muscle and liver tissues using AMAb90948 antibody. Corresponding MYH6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows very strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Lane 1: Marker [kDa]
Lane 2: Human skeletal muscle tissue lysate
AMAb90948
AMAb90948
AMAb90948