Anti-PARP1, IgG1, Clone: [CL2220], Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-PARP1, IgG1, Clone: [CL2220], Mouse, Monoclonal
• Artikelnummer: ATA-AMAB90959
• Hersteller Artikelnummer: AMAb90959
• Alternativnummer: ATA-AMAB90959-100,ATA-AMAB90959-25
• Hersteller: Atlas Antibodies
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ICC, IHC, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: ADPRT, PARP, PPOL, Pan-Cancer

Produktbeschreibung

poly (ADP-ribose) polymerase 1

Zusatzinformationen

Anti-PARP1

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1
• Klon-Bezeichnung: [CL2220]
• Isotyp: IgG1
• NCBI: 142
• UniProt: P09874
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Protein A purified
• Sequenz: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target-Kategorie: PARP1
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml

Bilder

Immunofluorescence staining in HeLa cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in A431 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in MCF7 cell line with Anti-PARP1 monoclonal antibody, showing clear cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in U2OS cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunofluorescence staining in U251 cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available).

Immunohistochemical staining of human fallopian tube shows strong nuclear immunoreactivity.

Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular and connective tissue cells.

Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.

Immunohistochemical staining of human cervix shows strong nuclear positivity in epithelial cells.

Immunohistochemical staining of human rectum shows strong nuclear immunoreactivity in the epithelial and lamina propria cells.

Immunohistochemical staining of human liver shows strong nuclear positivity in hepatocytes.

Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4

Lane 1: Marker [kDa]
Lane 2: Human cell line HeLa cytoplasmic fraction
Lane 3: Human cell line HeLa membrane fraction
Lane 4: Human cell line HeLa nuclear fraction
Lane 5: Human cell line HeLa chromatin fraction
Lane 6: Human cell line HeLa cytoskeletal fraction

AMAb90959

AMAb90959

AMAb90959