Anti-PARP1, IgG1, Clone: [CL2209], Mouse, Monoclonal

Artikelnummer: ATA-AMAB90960
Artikelname: Anti-PARP1, IgG1, Clone: [CL2209], Mouse, Monoclonal
Artikelnummer: ATA-AMAB90960
Hersteller Artikelnummer: AMAb90960
Alternativnummer: ATA-AMAB90960-100,ATA-AMAB90960-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADPRT, PARP, PPOL, Pan-Cancer
poly (ADP-ribose) polymerase 1
Anti-PARP1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL2209]
Isotyp: IgG1
NCBI: 142
UniProt: P09874
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PARP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunohistochemical staining of human skin shows strong nuclear immunoreactivity in both epidermis and dermis.
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in granular and molecular layer cells, as well as in Purkinje cells.
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast.
Immunohistochemical staining of human kidney shows nuclear positivity in both tubuli and glomeruli.
Immunohistochemical staining of human liver shows nuclear immunoreactivity in hepatocytes.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90960
AMAb90960
AMAb90960