Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91057
Artikelname: |
Anti-MUC16, IgG2b, Clone: [CL2783], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91057 |
Hersteller Artikelnummer: |
AMAb91057 |
Alternativnummer: |
ATA-AMAB91057-100,ATA-AMAB91057-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CA125, Pan-Cancer |
mucin 16, cell surface associated |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL2783] |
Isotyp: |
IgG2b |
NCBI: |
94025 |
UniProt: |
Q8WXI7 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
MUC16 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:500 - 1:1000 |
|
Immunohistochemical staining of human endometrium shows strong immunoreactivity in apical membranes of glandular cells. |
|
Immunohistochemical staining of human fallopian tube shows positivity in ciliated glandular cells. |
|
Immunohistochemical staining of human tonsil shows absence of immunoreactivity as expected (negative control). |
|
AMAb91057 |
|
AMAb91057 |
|
AMAb91057 |