Anti-TPH2, IgG1, Clone: [CL2990], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91108
Artikelname: Anti-TPH2, IgG1, Clone: [CL2990], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91108
Hersteller Artikelnummer: AMAb91108
Alternativnummer: ATA-AMAB91108-100,ATA-AMAB91108-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ37295, NTPH
tryptophan hydroxylase 2
Anti-TPH2
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL2990]
Isotyp: IgG1
NCBI: 121278
UniProt: Q8IWU9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TPH2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunofluorescence staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus.
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain.
Immunofluorescence staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex.
Immunohistochemical staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons.
Immunohistochemical staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.
AMAb91108
AMAb91108
AMAb91108