Anti-LAMA3, IgG1, Clone: [CL3112], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91123
Artikelname: |
Anti-LAMA3, IgG1, Clone: [CL3112], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91123 |
Hersteller Artikelnummer: |
AMAb91123 |
Alternativnummer: |
ATA-AMAB91123-100,ATA-AMAB91123-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa |
Klonalität: |
Monoclonal |
Konzentration: |
0.5 |
Klon-Bezeichnung: |
[CL3112] |
Isotyp: |
IgG1 |
NCBI: |
3909 |
UniProt: |
Q16787 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
LAMA3 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 1 µg/ml |
|
Immunohistochemical staining of human stomach shows moderate immunoreactivity in basement membrane of glandular epithelium. |
|
Immunohistochemical staining of human colon shows positivity in basement membrane of glandular epithelium. |
|
Immunohistochemical staining of human oral mucosa shows moderate immunoreactivity in basement membrane of squamous epithelium. |
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid tissue (negative control). |
|
Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221. |
|
AMAb91123 |
|
|
|
AMAb91123 |
|
AMAb91123 |