Anti-LAMA2, IgG1, Clone: [CL3450], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91166
- Bilder (13)
| Artikelname: | Anti-LAMA2, IgG1, Clone: [CL3450], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB91166 |
| Hersteller Artikelnummer: | AMAb91166 |
| Alternativnummer: | ATA-AMAB91166-100,ATA-AMAB91166-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LAMM |
| laminin, alpha 2 |
| Anti-LAMA2 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3450] |
| Isotyp: | IgG1 |
| NCBI: | 3908 |
| UniProt: | P24043 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LAMA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and tonsil tissues using AMAb91166 antibody. Corresponding LAMA2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in basement membrane of trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in blood vessels. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemical staining of rat heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of rat stomach shows strong positivity in basement membrane of glandular cells. |
|
|
Immunohistochemical staining of mouse heart muscle shows strong membranous positivity in cardiomyocytes. |
|
|
Western blot analysis of purified human recombinant Laminin-211, Laminin-221, Laminin-332, Laminin-421, Laminin-511 and Laminin-121. |
|
|
AMAb91166 |
|
|
|
|
|
AMAb91166 |
|
|
AMAb91166 |
Produktgarantie und fachkundiger Support
