Anti-PDCD1, IgG1, Clone: [CL3624], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91197
Artikelname: Anti-PDCD1, IgG1, Clone: [CL3624], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91197
Hersteller Artikelnummer: AMAb91197
Alternativnummer: ATA-AMAB91197-100,ATA-AMAB91197-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD279, hSLE1, PD1, SLEB2, Pan-Cancer
programmed cell death 1
Anti-PDCD1
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL3624]
Isotyp: IgG1
NCBI: 5133
UniProt: Q15116
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PDCD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells, mainly in the reaction centrum.
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401555)
AMAb91197
AMAb91197
AMAb91197