Anti-CTNNB1, IgG2a, Clone: [CL3689], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91209
- Bilder (15)
| Artikelname: | Anti-CTNNB1, IgG2a, Clone: [CL3689], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB91209 |
| Hersteller Artikelnummer: | AMAb91209 |
| Alternativnummer: | ATA-AMAB91209-100,ATA-AMAB91209-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | armadillo, beta-catenin, CTNNB, Pan-Cancer |
| catenin (cadherin-associated protein), beta 1, 88kDa |
| Anti-CTNNB1 |
| Klonalität: | Monoclonal |
| Konzentration: | 1 |
| Klon-Bezeichnung: | [CL3689] |
| Isotyp: | IgG2a |
| NCBI: | 1499 |
| UniProt: | P35222 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CTNNB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:20000 - 1:50000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows strong membranous immunoreactivity in glandular epithelium. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in renal tubules and glomerulus cells. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous immunoreactivity in epithelial cells. |
|
|
Immunohistochemical staining of human cervix shows strong membranous positivity in epithelial cells. |
|
|
Immunohistochemical staining of human breast cancer shows membranous immunoreactivity in tumor cells. |
|
|
Immunohistochemical staining of human prostate cancer shows membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity in muscle fibers (negative control). |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line SK-MEL-30 |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line A-549 |
|
|
AMAb91209 |
|
|
|
|
|
|
|
|
AMAb91209 |
|
|
AMAb91209 |
Produktgarantie und fachkundiger Support
