Anti-CTNNB1, IgG1, Clone: [CL3691], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91210
Artikelname: |
Anti-CTNNB1, IgG1, Clone: [CL3691], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91210 |
Hersteller Artikelnummer: |
AMAb91210 |
Alternativnummer: |
ATA-AMAB91210-100,ATA-AMAB91210-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
armadillo, beta-catenin, CTNNB, Pan-Cancer |
catenin (cadherin-associated protein), beta 1, 88kDa |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL3691] |
Isotyp: |
IgG1 |
NCBI: |
1499 |
UniProt: |
P35222 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
CTNNB1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 2-10 µg/ml, IHC: 1:10000 - 1:20000, WB: 1 µg/ml |
|
Immunohistochemical staining of human small intestine shows strong membranous immunoreactivity in the epithelial cells. |
|
Immunohistochemical staining of human cervix shows strong membranous positivity in epithelial cells. |
|
Immunohistochemical staining of human prostate shows membranous immunoreactivity in epithelial cells. |
|
Immunohistochemical staining of human fallopian tube shows strong membranous immunoreactivity in epithelial cells. |
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblast. |
|
Immunohistochemical staining of human prostate cancer shows membranous positivity in tumor cells. |
|
Immunohistochemical staining of human breast cancer shows membranous immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human renal cancer shows membranous positivity in tumor cells. |
|
Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity in muscle fibers (negative control). |
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line SK-MEL-30 |
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line A-549 |
|
|
|
|
|
AMAb91210 |
|
AMAb91210 |
|
AMAb91210 |