Anti-TP63, IgG1, Clone: [CL3748], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91224
Artikelname: Anti-TP63, IgG1, Clone: [CL3748], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91224
Hersteller Artikelnummer: AMAb91224
Alternativnummer: ATA-AMAB91224-100,ATA-AMAB91224-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EEC3, KET, NBP, OFC8, p51, p53CP, p63, p73H, p73L, SHFM4, TP53CP, TP53L, TP73L, Pan-Cancer
tumor protein p63
Anti-TP63
Klonalität: Monoclonal
Konzentration: 0.7
Klon-Bezeichnung: [CL3748]
Isotyp: IgG1
NCBI: 8626
UniProt: Q9H3D4
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: CACPGRDRKADEDSIRKQQVSDSTKNGDAFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TP63
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemical staining of human prostate cancer shows absence of nuclear immunoreactivity in tumor cells, while it is present in the adjacent normal a basal epithelial cells.
Immunohistochemical staining of human cervix shows strong nuclear immunoreactivity in epithelial cells.
Immunohistochemical staining of human prostate shows nuclear immunoreactivity in basal epithelial cells.
Immunohistochemical staining of human placenta shows nuclear positivity in a subset of cells.
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control).
Immunohistochemical staining of human lung cancer (adenocarcinoma) shows absence of immunoreactivity (negative control).
Western blot analysis in human cell line RT-4.
AMAb91224
AMAb91224
AMAb91224