Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91257
Artikelname: |
Anti-BRAF, IgG1, Clone: [CL4003], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91257 |
Hersteller Artikelnummer: |
AMAb91257 |
Alternativnummer: |
ATA-AMAB91257-100,ATA-AMAB91257-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
BRAF1, RAFB1, Pan-Cancer |
B-Raf proto-oncogene, serine/threonine kinase |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL4003] |
Isotyp: |
IgG1 |
NCBI: |
673 |
UniProt: |
P15056 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
BRAF |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in seminiferous tubules. |
|
Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil and cytoplasmic staining in some neurons. |
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular cells. |
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells. |
|
Western blot analysis in human cell line MOLT-4. |
|
AMAb91257 |
|
|
|
AMAb91257 |
|
AMAb91257 |