Anti-BRAF, IgG2b, Clone: [CL4004], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91258
Artikelname: Anti-BRAF, IgG2b, Clone: [CL4004], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91258
Hersteller Artikelnummer: AMAb91258
Alternativnummer: ATA-AMAB91258-100,ATA-AMAB91258-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BRAF1, RAFB1, Pan-Cancer
B-Raf proto-oncogene, serine/threonine kinase
Anti-BRAF
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL4004]
Isotyp: IgG2b
NCBI: 673
UniProt: P15056
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BRAF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells.
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells.
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules.
Western blot analysis in human cell line MOLT-4.
AMAb91258
AMAb91258
AMAb91258