Anti-BRAF Antibody 100ul, IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91258
Artikelname: |
Anti-BRAF Antibody 100ul, IgG2b, Clone: [CL4004], Unconjugated, Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91258 |
Hersteller Artikelnummer: |
AMAb91258 |
Alternativnummer: |
ATA-AMAB91258-100,ATA-AMAB91258-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
BRAF1, RAFB1 |
B-Raf proto-oncogene, serine/threonine kinase |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL4004] |
Isotyp: |
IgG2b |
NCBI: |
673 |
UniProt: |
P15056 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
BRAF |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
Immunohistochemical staining of human prostate cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells. |
|
Immunohistochemical staining of human breast cancer shows moderate cytoplasmic immunoreactivity in tumor cells. |
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules. |
|
Western blot analysis in human cell line MOLT-4. |
|
AMAb91258 |
|
|
|
AMAb91258 |
|
AMAb91258 |