Anti-ACE2, IgG1, Clone: [CL4035], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91262
Artikelname: Anti-ACE2, IgG1, Clone: [CL4035], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91262
Hersteller Artikelnummer: AMAb91262
Alternativnummer: ATA-AMAB91262-100,ATA-AMAB91262-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ACE2
angiotensin I converting enzyme 2

Anti-ACE2

 

The ACE2 receptor / a SAS Cov-2 cofactor

It is established that the ACE2 receptor is the main entry point for the SARS-CoV-2 virus in the lung (a host cell receptor for SARS-CoV-2; Hoffmann et al. 2020, Yan et al. 2020). ACE2 is mainly expressed on the surface of the cells within the lung, i.e. AECII-cells (Yan et al. 2020) and a transient bronchial secretory cell type transitioning from secretory to ciliated identity. These cells appear particularly vulnerable to SARS-CoV-2 infection (Lucassen et al. 2020 in press).

References:

Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8

Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114

Yan R et al. (2020) Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science, 6485,1444-1448

Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL4035]
Isotyp: IgG1
NCBI: 59272
UniProt: Q9BYF1
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ACE2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20000 - 1:50000, WB: 1 µg/ml
Immunohistochemical staining of human duodenum shows strong immunoreactivity in apical membranes of glandular cells.
Immunohistochemical staining of human small intestine shows strong positivity in apical membranes of glandular cells.
Immunohistochemical staining of human kidney shows strong membranous immunoreactivity in renal tubules.
Immunohistochemical staining of human heart muscle shows membranous positivity in cardiomyocytes.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control).
Western blot analysis in human kidney tissue.
AMAb91262
AMAb91262
AMAb91262