Anti-ACE2, IgG1, Clone: [CL4035], Mouse, Monoclonal
- Bilder (10)
Artikelname: | Anti-ACE2, IgG1, Clone: [CL4035], Mouse, Monoclonal |
Artikelnummer: | ATA-AMAB91262 |
Hersteller Artikelnummer: | AMAb91262 |
Alternativnummer: | ATA-AMAB91262-100,ATA-AMAB91262-25 |
Hersteller: | Atlas Antibodies |
Wirt: | Mouse |
Kategorie: | Antikörper |
Applikation: | IHC, WB |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | ACE2 |
angiotensin I converting enzyme 2 |
Anti-ACE2
The ACE2 receptor / a SAS Cov-2 cofactor It is established that the ACE2 receptor is the main entry point for the SARS-CoV-2 virus in the lung (a host cell receptor for SARS-CoV-2; Hoffmann et al. 2020, Yan et al. 2020). ACE2 is mainly expressed on the surface of the cells within the lung, i.e. AECII-cells (Yan et al. 2020) and a transient bronchial secretory cell type transitioning from secretory to ciliated identity. These cells appear particularly vulnerable to SARS-CoV-2 infection (Lucassen et al. 2020 in press). References: Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8 Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114 Yan R et al. (2020) Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science, 6485,1444-1448 |
Klonalität: | Monoclonal |
Konzentration: | 1 |
Klon-Bezeichnung: | [CL4035] |
Isotyp: | IgG1 |
NCBI: | 59272 |
UniProt: | Q9BYF1 |
Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Protein A purified |
Sequenz: | MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | ACE2 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:20000 - 1:50000, WB: 1 µg/ml |