Anti-SMCHD1, IgG2b, Clone: [CL4270], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91282
Artikelname: |
Anti-SMCHD1, IgG2b, Clone: [CL4270], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91282 |
Hersteller Artikelnummer: |
AMAb91282 |
Alternativnummer: |
ATA-AMAB91282-100,ATA-AMAB91282-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
KIAA0650 |
structural maintenance of chromosomes flexible hinge domain containing 1 |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL4270] |
Isotyp: |
IgG2b |
NCBI: |
23347 |
UniProt: |
A6NHR9 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
SMCHD1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 2-10 µg/ml, IHC: 1:50 - 1:200 |
|
Immunohistochemical staining of human small intestine shows strong nuclear immunoreactivity in glandular cells and in connective tissue cells. |
|
Immunohistochemical staining of human placenta shows strong nuclear immunoreactivity in trophoblast. |
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in seminiferous tubules cells. |
|
Immunohistochemical staining of human lymph node shows weak to moderate nuclear immunoreactivity in lymphoid cells. |
|
Immunohistochemical staining of human skeletal muscle shows no positivity as expected (negative control). |
|
|
|
AMAb91282 |
|
AMAb91282 |
|
AMAb91282 |