Anti-PRAME, IgG2a, Clone: [CL5146], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91329
| Artikelname: |
Anti-PRAME, IgG2a, Clone: [CL5146], Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB91329 |
| Hersteller Artikelnummer: |
AMAb91329 |
| Alternativnummer: |
ATA-AMAB91329-100,ATA-AMAB91329-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CT130, MAPE, Pan-Cancer |
| preferentially expressed antigen in melanoma |
| Klonalität: |
Monoclonal |
| Konzentration: |
1 |
| Klon-Bezeichnung: |
[CL5146] |
| Isotyp: |
IgG2a |
| NCBI: |
23532 |
| UniProt: |
P78395 |
| Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PRAME |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 2-10 µg/ml, WB: 1 µg/ml |
![]()
|
Western blot analysis in human cell line U-2 OS. |
![]()
|
AMAb91329 |
![]()
|
AMAb91329 |
