Anti-PRAME, IgG1, Clone: [CL5148], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91330
Artikelname: |
Anti-PRAME, IgG1, Clone: [CL5148], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91330 |
Hersteller Artikelnummer: |
AMAb91330 |
Alternativnummer: |
ATA-AMAB91330-100,ATA-AMAB91330-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CT130, MAPE, Pan-Cancer |
preferentially expressed antigen in melanoma |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL5148] |
Isotyp: |
IgG1 |
NCBI: |
23532 |
UniProt: |
P78395 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
PRAME |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:250 - 1:500, WB: 1 µg/ml |
|
Immunohistochemical staining of human testis shows moderate to strong nuclear immunoreactivity in a subset of cells in seminiferous tubules. |
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells. |
|
Immunohistochemical staining of human cervix shows absence of positivity as expected (negative control). |
|
Western blot analysis in human cell line U-2 OS. |
|
AMAb91330 |
|
|
|
AMAb91330 |
|
AMAb91330 |