Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91366
Artikelname: Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91366
Hersteller Artikelnummer: AMAb91366
Alternativnummer: ATA-AMAB91366-100,ATA-AMAB91366-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CCN2, IGFBP8, Pan-Cancer
connective tissue growth factor
Anti-CTGF
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL5339]
Isotyp: IgG1
NCBI: 1490
UniProt: P29279
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTGF
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of mouse brain shows cytoplasmic immunoreactivity in cortical layer 6b neurons.
Immunohistochemical staining of mouse cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.
Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.
Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in neurons in layer 6b.
Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in layer 6 neurons.
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid cells as expected (negative control).
Western blot analysis in human cell line U-251 MG.
AMAb91366
AMAb91366
AMAb91366