Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91366
Artikelname: |
Anti-CTGF, IgG1, Clone: [CL5339], Mouse, Monoclonal |
Artikelnummer: |
ATA-AMAB91366 |
Hersteller Artikelnummer: |
AMAb91366 |
Alternativnummer: |
ATA-AMAB91366-100,ATA-AMAB91366-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Mouse |
Kategorie: |
Antikörper |
Applikation: |
IHC, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CCN2, IGFBP8, Pan-Cancer |
connective tissue growth factor |
Klonalität: |
Monoclonal |
Konzentration: |
1 |
Klon-Bezeichnung: |
[CL5339] |
Isotyp: |
IgG1 |
NCBI: |
1490 |
UniProt: |
P29279 |
Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Protein A purified |
Sequenz: |
LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
CTGF |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
Immunohistochemical staining of mouse brain shows cytoplasmic immunoreactivity in cortical layer 6b neurons. |
|
Immunohistochemical staining of mouse cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons. |
|
Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons. |
|
Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in neurons in layer 6b. |
|
Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in layer 6 neurons. |
|
Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid cells as expected (negative control). |
|
Western blot analysis in human cell line U-251 MG. |
|
AMAb91366 |
|
|
|
AMAb91366 |
|
AMAb91366 |