Anti-GRN, IgG1, Clone: [CL5695], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91385
Artikelname: Anti-GRN, IgG1, Clone: [CL5695], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91385
Hersteller Artikelnummer: AMAb91385
Alternativnummer: ATA-AMAB91385-100,ATA-AMAB91385-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLN11, PCDGF, PGRN
granulin
Anti-GRN
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL5695]
Isotyp: IgG1
NCBI: 2896
UniProt: P28799
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GRN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic immunoreactivity in glandular cells.
Immunohistochemical staining of human liver shows cytoplasmic immunoreactivity in Kupffer cells.
Immunohistochemical staining of human prostate shows moderate granular cytoplasmic immunoreactivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows absence of positivity in striated muscle fibers as expected (negative control).
Western blot analysis in human cell line PC-3.
AMAb91385
AMAb91385
AMAb91385