Anti-ITGA5, IgG1, Clone: [CL6945], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91448
Artikelname: Anti-ITGA5, IgG1, Clone: [CL6945], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91448
Hersteller Artikelnummer: AMAb91448
Alternativnummer: ATA-AMAB91448-100,ATA-AMAB91448-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD49e, FNRA, Pan-Cancer
integrin subunit alpha 5
Anti-ITGA5
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL6945]
Isotyp: IgG1
NCBI: 3678
UniProt: P08648
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGA5
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human placenta and testis tissues using AMAb91448 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows strong apical membrane positivity in trophoblastic cells.
Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in smooth muscle cells.
Immunohistochemical staining of human liver shows moderate positivity in liver sinusoids.
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
AMAb91448
AMAb91448
AMAb91448