Anti-ITGA6, IgG1, Clone: [CL6957], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91450
Artikelname: Anti-ITGA6, IgG1, Clone: [CL6957], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91450
Hersteller Artikelnummer: AMAb91450
Alternativnummer: ATA-AMAB91450-100,ATA-AMAB91450-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD49f, Pan-Cancer
integrin subunit alpha 6
Anti-ITGA6
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL6957]
Isotyp: IgG1
NCBI: 3655
UniProt: P23229
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGA6
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using AMAb91450 antibody. Corresponding ITGA6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows strong basement membrane positivity in trophoblastic cells.
Immunohistochemical staining of human uterine cervix shows weak to moderate basement membrane positivity in squamous epithelium.
Immunohistochemical staining of human prostate shows weak to moderate basement membrane positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no membranous positivity in striated muscle fibers as expected.
AMAb91450
AMAb91450
AMAb91450