Anti-ITGA2, IgG1, Clone: [CL7318], Mouse, Monoclonal

Artikelnummer: ATA-AMAB91469
Artikelname: Anti-ITGA2, IgG1, Clone: [CL7318], Mouse, Monoclonal
Artikelnummer: ATA-AMAB91469
Hersteller Artikelnummer: AMAb91469
Alternativnummer: ATA-AMAB91469-100,ATA-AMAB91469-25
Hersteller: Atlas Antibodies
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD49B, Pan-Cancer
integrin subunit alpha 2
Anti-ITGA2
Klonalität: Monoclonal
Konzentration: 1
Klon-Bezeichnung: [CL7318]
Isotyp: IgG1
NCBI: 3673
UniProt: P17301
Puffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Protein A purified
Sequenz: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGA2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemistry analysis in human skin and skeletal muscle tissues using AMAb91469 antibody. Corresponding ITGA2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows strong membranous positivity in cells in basal layer of epidermis.
Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western blot analysis in human cell line RT-4.
AMAb91469
AMAb91469
AMAb91469