Anti-PGR, IgG1, Clone: [CL8721], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91529
- Bilder (4)
| Artikelname: | Anti-PGR, IgG1, Clone: [CL8721], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB91529 |
| Hersteller Artikelnummer: | AMAb91529 |
| Alternativnummer: | ATA-AMAB91529-100,ATA-AMAB91529-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NR3C3, PR, Pan-Cancer |
| progesterone receptor |
| Klonalität: | Monoclonal |
| Konzentration: | 0.8 |
| Klon-Bezeichnung: | [CL8721] |
| Isotyp: | IgG1 |
| NCBI: | 5241 |
| UniProt: | P06401 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | LLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPL |
| Target-Kategorie: | PGR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 2-10 µg/ml, IHC: 1:2500 - 1:5000 |
|
|
AMAb91529 |
|
|
|
|
|
AMAb91529 |
|
|
AMAb91529 |
Produktgarantie und fachkundiger Support
