Anti-KRT20, IgG1, Clone: [CL9390], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91564
| Artikelname: |
Anti-KRT20, IgG1, Clone: [CL9390], Mouse, Monoclonal |
| Artikelnummer: |
ATA-AMAB91564 |
| Hersteller Artikelnummer: |
AMAb91564 |
| Alternativnummer: |
ATA-AMAB91564-100,ATA-AMAB91564-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CK20, K20, MGC35423, Pan-Cancer |
| Klonalität: |
Monoclonal |
| Konzentration: |
1 |
| Klon-Bezeichnung: |
[CL9390] |
| Isotyp: |
IgG1 |
| NCBI: |
54474 |
| UniProt: |
P35900 |
| Puffer: |
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Protein A purified |
| Sequenz: |
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND |
| Target-Kategorie: |
KRT20 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200 |
![]()
|
AMAb91564 |
![]()
|
AMAb91564 |
![]()
|
AMAb91564 |
