Anti-AFP, IgG1, Clone: [CL9772], Mouse, Monoclonal
Artikelnummer:
ATA-AMAB91611
- Bilder (4)
| Artikelname: | Anti-AFP, IgG1, Clone: [CL9772], Mouse, Monoclonal |
| Artikelnummer: | ATA-AMAB91611 |
| Hersteller Artikelnummer: | AMAb91611 |
| Alternativnummer: | ATA-AMAB91611-100,ATA-AMAB91611-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FETA, HPAFP, Pan-Cancer |
| alpha fetoprotein |
| Klonalität: | Monoclonal |
| Konzentration: | 0.4 |
| Klon-Bezeichnung: | [CL9772] |
| Isotyp: | IgG1 |
| NCBI: | 174 |
| UniProt: | P02771 |
| Puffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Protein A purified |
| Sequenz: | FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR |
| Target-Kategorie: | AFP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
AMAb91611 |
|
|
|
|
|
AMAb91611 |
|
|
AMAb91611 |
Produktgarantie und fachkundiger Support
