Anti-GAB2, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000271
- Bilder (9)
Artikelname: | Anti-GAB2, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA000271 |
Hersteller Artikelnummer: | HPA000271 |
Alternativnummer: | ATA-HPA000271-25,ATA-HPA000271-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | KIAA0571 |
GRB2-associated binding protein 2 |
Anti-GAB2 |
Klonalität: | Polyclonal |
Konzentration: | 0.05 mg/ml |
Isotyp: | IgG |
NCBI: | 9846 |
UniProt: | Q9UQC2 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAERSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | GAB2 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:20 - 1:50 |