Anti-GAB2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000271
Artikelname: Anti-GAB2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000271
Hersteller Artikelnummer: HPA000271
Alternativnummer: ATA-HPA000271-25,ATA-HPA000271-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0571
GRB2-associated binding protein 2
Anti-GAB2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 9846
UniProt: Q9UQC2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAERSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GAB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA000271 antibody. Corresponding GAB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
HPA000271
HPA000271
HPA000271