Anti-ACE2, Rabbit, Polyclonal
- Bilder (10)
| Artikelname: | Anti-ACE2, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA000288 |
| Hersteller Artikelnummer: | HPA000288 |
| Alternativnummer: | ATA-HPA000288-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACE2 |
| angiotensin I converting enzyme 2 |
Anti-ACE2 The ACE2 receptor / a SAS Cov-2 cofactor It is established that the ACE2 receptor is the main entry point for the SARS-CoV-2 virus in the lung (a host cell receptor for SARS-CoV-2; Hoffmann et al. 2020, Yan et al. 2020). ACE2 is mainly expressed on the surface of the cells within the lung, i.e. AECII-cells (Yan et al. 2020) and a transient bronchial secretory cell type transitioning from secretory to ciliated identity. These cells appear particularly vulnerable to SARS-CoV-2 infection (Lucassen et al. 2020 in press). References: Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8 Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114 Yan R et al. (2020) Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science, 6485,1444-1448
|
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 59272 |
| UniProt: | Q9BYF1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACE2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human small intestine and tonsil tissues using HPA000288 antibody. Corresponding ACE2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows strong positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows strong positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong positivity in apical membrane in cells in tubules. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Western blot analysis in human kidney tissue. |
|
|
HPA000288 |
|
|
|
|
|
HPA000288 |
|
|
HPA000288 |
