Anti-ZNF185, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000400
Artikelname: Anti-ZNF185, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000400
Hersteller Artikelnummer: HPA000400
Alternativnummer: ATA-HPA000400-25,ATA-HPA000400-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ZNF185
zinc finger protein 185 (LIM domain)
Anti-ZNF185
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 7739
UniProt: O15231
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PADPSTPEQQNSPSGSEQFVRRESCTSRVRSPSSCMVTVTVTATSEQPHIYIPAPASELDSSSTTKGILFVKEYVSEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGST
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZNF185
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human epididymis and liver tissues using Anti-ZNF185 antibody. Corresponding ZNF185 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human epididymis, liver, lymph node and testis using Anti-ZNF185 antibody HPA000400 (A) shows similar protein distribution across tissues to independent antibody HPA016438 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human epididymis shows high expression.
Immunohistochemical staining of human lymph node using Anti-ZNF185 antibody HPA000400.
Immunohistochemical staining of human testis using Anti-ZNF185 antibody HPA000400.
HPA000400
HPA000400
HPA000400