Anti-ARHGAP12, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000412
Artikelname: Anti-ARHGAP12, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000412
Hersteller Artikelnummer: HPA000412
Alternativnummer: ATA-HPA000412-25,ATA-HPA000412-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ10971, FLJ20737, FLJ21785
Rho GTPase activating protein 12
Anti-ARHGAP12
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 94134
UniProt: Q8IWW6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYSSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ARHGAP12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and skeletal muscle tissues using Anti-ARHGAP12 antibody. Corresponding ARHGAP12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line CAPAN-2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA000412
HPA000412
HPA000412