Anti-IKBKG, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000426
Artikelname: |
Anti-IKBKG, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA000426 |
Hersteller Artikelnummer: |
HPA000426 |
Alternativnummer: |
ATA-HPA000426-25,ATA-HPA000426-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9 |
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma |
Klonalität: |
Polyclonal |
Konzentration: |
0.2 mg/ml |
Isotyp: |
IgG |
NCBI: |
8517 |
UniProt: |
Q9Y6K9 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
IKBKG |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells. |
|
Western blot analysis in human cell line HepG2. |
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
HPA000426 |
|
|
|
|
|
HPA000426 |
|
HPA000426 |