Anti-IKBKG, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000426
Artikelname: Anti-IKBKG, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000426
Hersteller Artikelnummer: HPA000426
Alternativnummer: ATA-HPA000426-25,ATA-HPA000426-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
Anti-IKBKG
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 8517
UniProt: Q9Y6K9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQAL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IKBKG
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Western blot analysis in human cell line HepG2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA000426
HPA000426
HPA000426