Anti-KRT17, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000452
- Bilder (9)
| Artikelname: | Anti-KRT17, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA000452 |
| Hersteller Artikelnummer: | HPA000452 |
| Alternativnummer: | ATA-HPA000452-25,ATA-HPA000452-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PCHC1 |
| keratin 17, type I |
| Anti-KRT17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3872 |
| UniProt: | Q04695 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ARDYSQYYRTIEELQNKILTATVDNILLQIDRLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMLRGQVGGEINVEMDAAPGVDLSRI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KRT17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line hTCEpi shows localization to intermediate filaments. |
|
|
Immunohistochemical staining of human skin shows distinct positivity in keratinocytes. |
|
|
Western blot analysis in human cell lines HeLa and PC-3 using Anti-KRT17 antibody. Corresponding KRT17 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA000452 |
|
|
|
|
|
|
|
|
HPA000452 |
|
|
HPA000452 |
Produktgarantie und fachkundiger Support
