Anti-LGALS3BP, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000554
Artikelname: Anti-LGALS3BP, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000554
Hersteller Artikelnummer: HPA000554
Alternativnummer: ATA-HPA000554-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
lectin, galactoside-binding, soluble, 3 binding protein
Anti-LGALS3BP
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 3959
UniProt: Q08380
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LGALS3BP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-LGALS3BP antibody. Corresponding LGALS3BP RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
HPA000554
HPA000554
HPA000554