Anti-G6PD, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000834
- Bilder (14)
| Artikelname: | Anti-G6PD, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA000834 |
| Hersteller Artikelnummer: | HPA000834 |
| Alternativnummer: | ATA-HPA000834-25,ATA-HPA000834-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G6PD1 |
| glucose-6-phosphate dehydrogenase |
| Anti-G6PD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2539 |
| UniProt: | P11413 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMLH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | G6PD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm. |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA000834 antibody. Corresponding G6PD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-G6PD antibody. Corresponding G6PD RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-G6PD antibody HPA000834 (A) shows similar pattern to independent antibody HPA000247 (B). |
|
|
HPA000834 |
|
|
|
|
|
|
|
|
HPA000834 |
|
|
HPA000834 |
Produktgarantie und fachkundiger Support
