Anti-NKAP, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000916
Artikelname: Anti-NKAP, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000916
Hersteller Artikelnummer: HPA000916
Alternativnummer: ATA-HPA000916-25,ATA-HPA000916-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ22626
NFKB activating protein
Anti-NKAP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 79576
UniProt: Q8N5F7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NKAP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human tonsil shows nuclear positivity in lymphoid cells.
Immunohistochemical staining of human cerebral cortex shows nuclear positivity in neurons.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
HPA000916
HPA000916
HPA000916