Anti-SERPINA1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000927
- Bilder (16)
| Artikelname: | Anti-SERPINA1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA000927 |
| Hersteller Artikelnummer: | HPA000927 |
| Alternativnummer: | ATA-HPA000927-25,ATA-HPA000927-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1, Pan-Cancer |
| serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
| Anti-SERPINA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5265 |
| UniProt: | P01009 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SERPINA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. |
|
|
Immunohistochemistry analysis in human kidney and cerebral cortex tissues using Anti-SERPINA1 antibody. Corresponding SERPINA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver, lung, lymph node and testis using Anti-SERPINA1 antibody HPA000927 (A) shows similar protein distribution across tissues to independent antibody HPA001292 (B). |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-SERPINA1 antibody HPA000927. |
|
|
Immunohistochemical staining of human lung using Anti-SERPINA1 antibody HPA000927. |
|
|
Immunohistochemical staining of human liver using Anti-SERPINA1 antibody HPA000927. |
|
|
Immunohistochemical staining of human lymph node using Anti-SERPINA1 antibody HPA000927. |
|
|
Western blot analysis using Anti-SERPINA1 antibody HPA000927 (A) shows similar pattern to independent antibody HPA001292 (B). |
|
|
Western blot analysis in human plasma. |
|
|
HPA000927 |
|
|
|
|
|
|
|
|
HPA000927 |
|
|
HPA000927 |
Produktgarantie und fachkundiger Support
