Anti-STAT1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA000931
- Bilder (9)
| Artikelname: | Anti-STAT1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA000931 |
| Hersteller Artikelnummer: | HPA000931 |
| Alternativnummer: | ATA-HPA000931-25,ATA-HPA000931-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ISGF-3, STAT91 |
| signal transducer and activator of transcription 1, 91kDa |
| Anti-STAT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6772 |
| UniProt: | P42224 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FQEDPIQMSMIIYSCLKEERKILEQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STAT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in non-germinal center cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis using Anti-STAT1 antibody HPA000931 (A) shows similar pattern to independent antibody HPA000982 (B). |
|
|
HPA000931 |
|
|
|
|
|
|
|
|
HPA000931 |
|
|
HPA000931 |
Produktgarantie und fachkundiger Support
