Anti-CSTA, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001031
- Bilder (9)
| Artikelname: | Anti-CSTA, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA001031 |
| Hersteller Artikelnummer: | HPA001031 |
| Alternativnummer: | ATA-HPA001031-25,ATA-HPA001031-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | STF1, STFA |
| cystatin A (stefin A) |
| Anti-CSTA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1475 |
| UniProt: | P01040 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CSTA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line hTCEpi shows localization to nucleus & cytosol. |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic and nuclear positivity in squamous epithelial cells. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CSTA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human esophagus tissue. |
|
|
HPA001031 |
|
|
|
|
|
|
|
|
HPA001031 |
|
|
HPA001031 |
Produktgarantie und fachkundiger Support
