Anti-YY1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001119
Artikelname: Anti-YY1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001119
Hersteller Artikelnummer: HPA001119
Alternativnummer: ATA-HPA001119-25,ATA-HPA001119-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
YY1 transcription factor
Anti-YY1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7528
UniProt: P25490
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: YY1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human lymph node shows strong nuclear positivity.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human pancreas moderate nuclear positivity in exocrine glandular cells.
Western blot analysis in human cell line HL-60.
HPA001119
HPA001119
HPA001119