Anti-EGFR, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001200
Artikelname: Anti-EGFR, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001200
Hersteller Artikelnummer: HPA001200
Alternativnummer: ATA-HPA001200-25,ATA-HPA001200-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERBB, ERBB1, Pan-Cancer
epidermal growth factor receptor
Anti-EGFR
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1956
UniProt: P00533
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EFKDSLSITNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EGFR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA001200 antibody. Corresponding EGFR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
HPA001200
HPA001200
HPA001200