Anti-STX17, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001204
- Bilder (9)
| Artikelname: | Anti-STX17, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA001204 |
| Hersteller Artikelnummer: | HPA001204 |
| Alternativnummer: | ATA-HPA001204-25,ATA-HPA001204-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20651 |
| syntaxin 17 |
| Anti-STX17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55014 |
| UniProt: | P56962 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHIGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STX17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
HPA001204 |
|
|
|
|
|
HPA001204 |
|
|
HPA001204 |
Produktgarantie und fachkundiger Support
