Anti-ERBB2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001338
Artikelname: Anti-ERBB2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001338
Hersteller Artikelnummer: HPA001338
Alternativnummer: ATA-HPA001338-25,ATA-HPA001338-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD340, HER-2, HER2, NEU, NGL, Pan-Cancer
erb-b2 receptor tyrosine kinase 2
Anti-ERBB2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 2064
UniProt: P04626
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ERBB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
HPA001338