Anti-CDH13, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001380
Artikelname: Anti-CDH13, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001380
Hersteller Artikelnummer: HPA001380
Alternativnummer: ATA-HPA001380-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CDHH
cadherin 13
Anti-CDH13
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1012
UniProt: P55290
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GTGTLLITLEDVNDPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCAGALRFSLPSVLLLSLFSLA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDH13
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane.
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-CDH13 antibody. Corresponding CDH13 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell line U-138MG.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400505)
HPA001380
HPA001380