Anti-ERBB2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001383
Artikelname: |
Anti-ERBB2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA001383 |
Hersteller Artikelnummer: |
HPA001383 |
Alternativnummer: |
ATA-HPA001383-100,ATA-HPA001383-25 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC, WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CD340, HER-2, HER2, NEU, NGL |
erb-b2 receptor tyrosine kinase 2 |
Klonalität: |
Polyclonal |
Konzentration: |
0.1 mg/ml |
Isotyp: |
IgG |
NCBI: |
2064 |
UniProt: |
P04626 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
ERBB2 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane. |
|
Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells. |
|
Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected. |
|
Western blot analysis in human cell line SK-BR-3. |
|
HPA001383 |
|
|
|
|
|
HPA001383 |
|
HPA001383 |