Anti-ERBB2, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA001383
- Bilder (9)
| Artikelname: | Anti-ERBB2, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA001383 |
| Hersteller Artikelnummer: | HPA001383 |
| Alternativnummer: | ATA-HPA001383-25,ATA-HPA001383-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD340, HER-2, HER2, NEU, NGL, Pan-Cancer |
| erb-b2 receptor tyrosine kinase 2 |
| Anti-ERBB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2064 |
| UniProt: | P04626 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ERBB2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells. |
|
|
Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA001383 |
|
|
|
|
|
|
|
|
HPA001383 |
|
|
HPA001383 |
Produktgarantie und fachkundiger Support
