Anti-FLOT2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001396
Artikelname: Anti-FLOT2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001396
Hersteller Artikelnummer: HPA001396
Alternativnummer: ATA-HPA001396-25,ATA-HPA001396-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ECS-1, ECS1, ESA, ESA1, M17S1
flotillin 2
Anti-FLOT2
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 2319
UniProt: Q14254
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FLOT2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-FLOT2 antibody. Corresponding FLOT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line RT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001396
HPA001396
HPA001396